HORDB

ID: hor002385
Uniprot ID: Q9XSE2
Protein name: Motilin
Gene name: MLN
Organism: Felis catus (Cat) (Felis silvestris catus)
Family: Motilin family
Source: animal
Expression: NA
Disease: NA
Comments: NA
Taxonomy: Felis (genus), Felinae (subfamily), Felidae (family), Feliformia (suborder), Carnivora (order), Laurasiatheria (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
GO MF: GO:0005179 hormone activity; GO:0031788 motilin receptor binding
GO BP: GO:0007165 signal transduction
GO CC: GO:0005576 extracellular region

Sequence: FVPIFTHSELQRIREKERNKGQ
Length: 22
Propeptide: MVSRKAVAVLLMVHVAVMLASQTEAFVPIFTHSELQRIREKERNKGQKKSLIVQQRSEEVGPLDPVEPPEEEENEVIKLTAPVAIGTRMNSRQLEKYRAALEGLLSEVLLPARNDK
Signal peptide: MVSRKAVAVLLMVHVAVMLASQTEA
Modification: NA
Glycosylation: NA
Mutagenesis: NA

Function: Plays an important role in the regulation of interdigestive gastrointestinal motility and indirectly causes rhythmic contraction of duodenal and colonic smooth muscle.
Mechanism: NA
Cross BBB: NA
Target: NA
Target Unid: NA
IC50: NA
EC50: NA
ED50: NA
kd: NA
Half life: NA

Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)

hor002385_AF2.pdb

hor002385_ESM.pdb

Mass:	308783	Formula:	C120H194N38O34
Absent amino acids:	ACDMWY	Common amino acids:	ER
pI:	10.76	Basic residues:	6
Polar residues:	4	Hydrophobic residues:	6
Hydrophobicity:	-120	Boman Index:	-7894
Half-Life:	1.1 hour	Half-Life Yeast:	3 min
Half-Life E.Coli:	2 min	Aliphatic Index	66.36
Instability Index:	5438.64	Extinction Coefficient cystines:	0
Absorbance 280nm:	0