General Information

  • ID:  hor002385
  • Uniprot ID:  Q9XSE2(26-47)
  • Protein name:  Motilin
  • Gene name:  MLN
  • Organism:  Felis catus (Cat) (Felis silvestris catus)
  • Family:  Motilin family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Felis (genus), Felinae (subfamily), Felidae (family), Feliformia (suborder), Carnivora (order), Laurasiatheria (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0031788 motilin receptor binding
  • GO BP:  GO:0007165 signal transduction
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  FVPIFTHSELQRIREKERNKGQ
  • Length:  22(26-47)
  • Propeptide:  MVSRKAVAVLLMVHVAVMLASQTEAFVPIFTHSELQRIREKERNKGQKKSLIVQQRSEEVGPLDPVEPPEEEENEVIKLTAPVAIGTRMNSRQLEKYRAALEGLLSEVLLPARNDK
  • Signal peptide:  MVSRKAVAVLLMVHVAVMLASQTEA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Plays an important role in the regulation of interdigestive gastrointestinal motility and indirectly causes rhythmic contraction of duodenal and colonic smooth muscle.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q9XSE2-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor002385_AF2.pdbhor002385_ESM.pdb

    Please select some value
    Remove Label
    Add Label

    Please select some value
    Remove Label
    Add Label

Physical Information

Mass: 308783 Formula: C120H194N38O34
Absent amino acids: ACDMWY Common amino acids: ER
pI: 10.76 Basic residues: 6
Polar residues: 4 Hydrophobic residues: 6
Hydrophobicity: -120 Boman Index: -7894
Half-Life: 1.1 hour Half-Life Yeast: 3 min
Half-Life E.Coli: 2 min Aliphatic Index 66.36
Instability Index: 5438.64 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  NA
  • Title:  NA